Recombinant Saccharomyces cerevisiae Protein SIP18 (SIP18)

Artikelnummer: CSB-EP343468SVG
Artikelname: Recombinant Saccharomyces cerevisiae Protein SIP18 (SIP18)
Artikelnummer: CSB-EP343468SVG
Hersteller Artikelnummer: CSB-EP343468SVG
Alternativnummer: CSB-EP343468SVG-1, CSB-EP343468SVG-100, CSB-EP343468SVG-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 15.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P50263
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.180.
Quelle: E.coli
Expression System: 1-79aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK
Anwendungsbeschreibung: Research Areas: Others