Recombinant Saccharomyces cerevisiae Protein SIP18 (SIP18)

Catalog Number: CSB-EP343468SVG
Article Name: Recombinant Saccharomyces cerevisiae Protein SIP18 (SIP18)
Biozol Catalog Number: CSB-EP343468SVG
Supplier Catalog Number: CSB-EP343468SVG
Alternative Catalog Number: CSB-EP343468SVG-1, CSB-EP343468SVG-100, CSB-EP343468SVG-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 15.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P50263
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.180.
Source: E.coli
Expression System: 1-79aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK
Application Notes: Research Areas: Others