Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

Artikelnummer: CSB-EP357716FKZE1
Artikelname: Recombinant Staphylococcus aureus Alpha-hemolysin (hly)
Artikelnummer: CSB-EP357716FKZE1
Hersteller Artikelnummer: CSB-EP357716FKZe1
Alternativnummer: CSB-EP357716FKZE1-1, CSB-EP357716FKZE1-100, CSB-EP357716FKZE1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Alpha-HL)(Alpha-toxin)
Molekulargewicht: 33.4 kDa
Tag: Tag-Free
UniProt: P09616
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 27-319aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.