Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

Catalog Number: CSB-EP357716FKZE1
Article Name: Recombinant Staphylococcus aureus Alpha-hemolysin (hly)
Biozol Catalog Number: CSB-EP357716FKZE1
Supplier Catalog Number: CSB-EP357716FKZe1
Alternative Catalog Number: CSB-EP357716FKZE1-1, CSB-EP357716FKZE1-100, CSB-EP357716FKZE1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Alpha-HL)(Alpha-toxin)
Molecular Weight: 33.4 kDa
Tag: Tag-Free
UniProt: P09616
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 27-319aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDD
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.