Recombinant Shigella flexneri Glutaredoxin-4 (grxD)
Artikelnummer:
CSB-EP364758SZB
- Bilder (0)
| Artikelname: | Recombinant Shigella flexneri Glutaredoxin-4 (grxD) |
| Artikelnummer: | CSB-EP364758SZB |
| Hersteller Artikelnummer: | CSB-EP364758SZB |
| Alternativnummer: | CSB-EP364758SZB-1, CSB-EP364758SZB-100, CSB-EP364758SZB-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Monothiol glutaredoxin (ydhD) (Grx4) |
| Molekulargewicht: | 28.9 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P0AC72 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 1-115aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE |
Produktgarantie und fachkundiger Support
