Recombinant Shigella flexneri Glutaredoxin-4 (grxD)

Catalog Number: CSB-EP364758SZB
Article Name: Recombinant Shigella flexneri Glutaredoxin-4 (grxD)
Biozol Catalog Number: CSB-EP364758SZB
Supplier Catalog Number: CSB-EP364758SZB
Alternative Catalog Number: CSB-EP364758SZB-1, CSB-EP364758SZB-100, CSB-EP364758SZB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Monothiol glutaredoxin (ydhD) (Grx4)
Molecular Weight: 28.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P0AC72
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-115aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364758SZB could indicate that this peptide derived from E.coli-expressed