Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim13(tim13),Escherichia Coli Preis auf Anfrage

Artikelnummer: CSB-EP604610SXV
Artikelname: Recombinant Schizosaccharomyces pombe Mitochondrial import inner membrane translocase subunit tim13(tim13),Escherichia Coli Preis auf Anfrage
Artikelnummer: CSB-EP604610SXV
Hersteller Artikelnummer: CSB-EP604610SXV
Alternativnummer: CSB-EP604610SXV-1,CSB-EP604610SXV-100,CSB-EP604610SXV-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Alternative Synonym: Recommended name: Mitochondrial import inner membrane translocase subunit tim13
Tag: The tag type will be determined during production process.
UniProt: Q10481
Puffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Quelle: E.coli
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: MGIFGGNSGNAPSSEDKKSIFMKQIRQELAVAQAGELISKINENCFDKCIPEPGSTFDPN EKSCVSKCMERYMDAWNIVSRTYISRMQREQKNLN
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.