Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial

Produktübersicht

• Artikelname: Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial
• Artikelnummer: CSB-EP614255HU
• Hersteller Artikelnummer: CSB-EP614255HU
• Alternativnummer: CSB-EP614255HU-1, CSB-EP614255HU-100, CSB-EP614255HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)

Produkteigenschaften

• Molekulargewicht: 20.0 kDa
• Tag: C-terminal 6xHis-HPC4-tagged
• UniProt: Q12791
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 411-560aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP614255HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.