Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial
Catalog Number:
CSB-EP614255HU
- Images (0)
| Article Name: | Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial |
| Biozol Catalog Number: | CSB-EP614255HU |
| Supplier Catalog Number: | CSB-EP614255HU |
| Alternative Catalog Number: | CSB-EP614255HU-1, CSB-EP614255HU-100, CSB-EP614255HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO) |
| Molecular Weight: | 20.0 kDa |
| Tag: | C-terminal 6xHis-HPC4-tagged |
| UniProt: | Q12791 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 411-560aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA |
Product Guarantee and Expert Support
