Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial

Catalog Number: CSB-EP614255HU
Article Name: Recombinant Human Calcium-activated potassium channel subunit alpha-1 (KCNMA1), partial
Biozol Catalog Number: CSB-EP614255HU
Supplier Catalog Number: CSB-EP614255HU
Alternative Catalog Number: CSB-EP614255HU-1, CSB-EP614255HU-100, CSB-EP614255HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: BK channel (BKCA alpha) (Calcium-activated potassium channel, subfamily M subunit alpha-1) (K(VCA)alpha) (KCa1.1) (Maxi K channel) (MaxiK) (Slo-alpha) (Slo1) (Slowpoke homolog) (Slo homolog) (hSlo) (KCNMA) (SLO)
Molecular Weight: 20.0 kDa
Tag: C-terminal 6xHis-HPC4-tagged
UniProt: Q12791
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 411-560aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP614255HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNMA1.