Recombinant Human Ubiquitin-like protein NEDD8 (NEDD8)

Artikelnummer: CSB-EP618018HUC7
Artikelname: Recombinant Human Ubiquitin-like protein NEDD8 (NEDD8)
Artikelnummer: CSB-EP618018HUC7
Hersteller Artikelnummer: CSB-EP618018HUc7
Alternativnummer: CSB-EP618018HUC7-1, CSB-EP618018HUC7-100, CSB-EP618018HUC7-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Neddylin,Neural precursor cell expressed developmentally down-regulated protein 8
Molekulargewicht: 16.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q15843
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.194.
Quelle: E.coli
Expression System: 1-81aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Anwendungsbeschreibung: Research Areas: Cell Biology