Recombinant Human Ubiquitin-like protein NEDD8 (NEDD8)

Catalog Number: CSB-EP618018HUC7
Article Name: Recombinant Human Ubiquitin-like protein NEDD8 (NEDD8)
Biozol Catalog Number: CSB-EP618018HUC7
Supplier Catalog Number: CSB-EP618018HUc7
Alternative Catalog Number: CSB-EP618018HUC7-1, CSB-EP618018HUC7-100, CSB-EP618018HUC7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Neddylin,Neural precursor cell expressed developmentally down-regulated protein 8
Molecular Weight: 16.0 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q15843
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.194.
Source: E.coli
Expression System: 1-81aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
Application Notes: Research Areas: Cell Biology