Recombinant Human Flotillin-2 (FLOT2)

Artikelnummer: CSB-EP619868HUA0
Artikelname: Recombinant Human Flotillin-2 (FLOT2)
Artikelnummer: CSB-EP619868HUA0
Hersteller Artikelnummer: CSB-EP619868HUa0
Alternativnummer: CSB-EP619868HUA0-1, CSB-EP619868HUA0-100, CSB-EP619868HUA0-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Epidermal surface antigen,Membrane component chromosome 17 surface marker 1
Molekulargewicht: 52.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q14254
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.185.
Quelle: E.coli
Expression System: 2-428aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEE
Anwendungsbeschreibung: Research Areas: Neuroscience