Recombinant Human Flotillin-2 (FLOT2)

Catalog Number: CSB-EP619868HUA0
Article Name: Recombinant Human Flotillin-2 (FLOT2)
Biozol Catalog Number: CSB-EP619868HUA0
Supplier Catalog Number: CSB-EP619868HUa0
Alternative Catalog Number: CSB-EP619868HUA0-1, CSB-EP619868HUA0-100, CSB-EP619868HUA0-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Epidermal surface antigen,Membrane component chromosome 17 surface marker 1
Molecular Weight: 52.9 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q14254
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.185.
Source: E.coli
Expression System: 2-428aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEE
Application Notes: Research Areas: Neuroscience