Recombinant Serratia marcescens Hemophore HasA (hasA)

Artikelnummer: CSB-EP684482SYN
Artikelname: Recombinant Serratia marcescens Hemophore HasA (hasA)
Artikelnummer: CSB-EP684482SYN
Hersteller Artikelnummer: CSB-EP684482SYN
Alternativnummer: CSB-EP684482SYN-1, CSB-EP684482SYN-100, CSB-EP684482SYN-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Heme acquisition system protein A
Molekulargewicht: 35.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q54450
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-188aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.