Recombinant Serratia marcescens Hemophore HasA (hasA)

Catalog Number: CSB-EP684482SYN
Article Name: Recombinant Serratia marcescens Hemophore HasA (hasA)
Biozol Catalog Number: CSB-EP684482SYN
Supplier Catalog Number: CSB-EP684482SYN
Alternative Catalog Number: CSB-EP684482SYN-1, CSB-EP684482SYN-100, CSB-EP684482SYN-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Heme acquisition system protein A
Molecular Weight: 35.3 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q54450
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-188aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.