Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)

Artikelnummer: CSB-EP6891BZL
Artikelname: Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)
Artikelnummer: CSB-EP6891BZL
Hersteller Artikelnummer: CSB-EP6891BZL
Alternativnummer: CSB-EP6891BZL-1, CSB-EP6891BZL-100, CSB-EP6891BZL-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: OBP-3
Molekulargewicht: 21.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8T6R8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 30-153aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: DEPRRDANYPPPELLEKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCLFHQAGVVNDKGEFHYVKIQDFLPESMHLITLNWFKRCLYPEGENGCEKAFWLNKCWKTRDPVHYFLP
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.