Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)

Catalog Number: CSB-EP6891BZL
Article Name: Recombinant Anopheles gambiaeA GAP001409-PA (OBP-3)
Biozol Catalog Number: CSB-EP6891BZL
Supplier Catalog Number: CSB-EP6891BZL
Alternative Catalog Number: CSB-EP6891BZL-1, CSB-EP6891BZL-100, CSB-EP6891BZL-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: OBP-3
Molecular Weight: 21.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8T6R8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 30-153aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DEPRRDANYPPPELLEKMKPMHDACVAETGASEDAIKRFSDQEIHEDDKLKCYMNCLFHQAGVVNDKGEFHYVKIQDFLPESMHLITLNWFKRCLYPEGENGCEKAFWLNKCWKTRDPVHYFLP
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.