Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

Artikelnummer: CSB-EP691989FLB
Artikelname: Recombinant Staphylococcus aureus DNA-binding protein HU (hup)
Artikelnummer: CSB-EP691989FLB
Hersteller Artikelnummer: CSB-EP691989FLB
Alternativnummer: CSB-EP691989FLB-1, CSB-EP691989FLB-100, CSB-EP691989FLB-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 16.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5HFV0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-90aa
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.