Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

Produktübersicht

• Artikelname: Recombinant Staphylococcus aureus DNA-binding protein HU (hup)
• Artikelnummer: CSB-EP691989FLB
• Hersteller Artikelnummer: CSB-EP691989FLB
• Alternativnummer: CSB-EP691989FLB-1, CSB-EP691989FLB-100, CSB-EP691989FLB-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 16.5 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q5HFV0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-90aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK