Recombinant Staphylococcus aureus DNA-binding protein HU (hup)

Catalog Number: CSB-EP691989FLB
Article Name: Recombinant Staphylococcus aureus DNA-binding protein HU (hup)
Biozol Catalog Number: CSB-EP691989FLB
Supplier Catalog Number: CSB-EP691989FLB
Alternative Catalog Number: CSB-EP691989FLB-1, CSB-EP691989FLB-100, CSB-EP691989FLB-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 16.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q5HFV0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-90aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKGRNPQTGKEIDIPASKVPAFKAGKALKDAVK
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.