Recombinant Rat Meteorin-like protein (Metrnl)

Produktübersicht

• Artikelname: Recombinant Rat Meteorin-like protein (Metrnl)
• Artikelnummer: CSB-EP719323RA
• Hersteller Artikelnummer: CSB-EP719323RA
• Alternativnummer: CSB-EP719323RA-1, CSB-EP719323RA-100, CSB-EP719323RA-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Subfatin

Produkteigenschaften

• Molekulargewicht: 33.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q5RJL6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 46-311aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: QYSSDLCSWKGSGLTREAHSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDVRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIHLRVSRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQKMYRKAEE