Recombinant Rat Meteorin-like protein (Metrnl)

Catalog Number: CSB-EP719323RA
Article Name: Recombinant Rat Meteorin-like protein (Metrnl)
Biozol Catalog Number: CSB-EP719323RA
Supplier Catalog Number: CSB-EP719323RA
Alternative Catalog Number: CSB-EP719323RA-1, CSB-EP719323RA-100, CSB-EP719323RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Subfatin
Molecular Weight: 33.8 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q5RJL6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 46-311aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYSSDLCSWKGSGLTREAHSKEVEQVYLRCSAGSVEWMYPTGALIVNLRPNTFSPAQNLTVCIKPFRDSSGANIYLEKTGELRLLVRDVRGEPGQVQCFSLEQGGLFVEATPQQDISRRTTGFQYELMSGQRGLDLHVLSAPCRPCSDTEVLLAICTSDFVVRGFIEDVTHVPEQQVSVIHLRVSRLHRQKSRVFQPAPEDSGHWLGHVTTLLQCGVRPGHGEFLFTGHVHFGEAQLGCAPRFSDFQKMYRKAEE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.