Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)

Produktübersicht

• Artikelname: Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)
• Artikelnummer: CSB-EP720181MO
• Hersteller Artikelnummer: CSB-EP720181MO
• Alternativnummer: CSB-EP720181MO-1, CSB-EP720181MO-100, CSB-EP720181MO-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cell death protein RIP (Receptor-interacting protein 1) (RIP-1) (Rinp) (Rip)

Produkteigenschaften

• Molekulargewicht: 78.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q60855
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 1-656aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILE

Bilder

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720181MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ripk1.