Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)

Product Overview

• Article Name: Recombinant Mouse Receptor-interacting serine/threonine-protein kinase 1 (Ripk1)
• Biozol Catalog Number: CSB-EP720181MO
• Supplier Catalog Number: CSB-EP720181MO
• Alternative Catalog Number: CSB-EP720181MO-1, CSB-EP720181MO-100, CSB-EP720181MO-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Cell death protein RIP (Receptor-interacting protein 1) (RIP-1) (Rinp) (Rip)

Product Properties

• Molecular Weight: 78.9 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q60855
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Expression System: 1-656aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVLLEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIVEAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVSSTTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVICIKSGNRPNVEEILE

Images

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720181MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ripk1.