Recombinant Mouse Versican core protein (Vcan), partial

Produktübersicht

• Artikelname: Recombinant Mouse Versican core protein (Vcan), partial
• Artikelnummer: CSB-EP720284MOC7
• Hersteller Artikelnummer: CSB-EP720284MOc7
• Alternativnummer: CSB-EP720284MOC7-1,CSB-EP720284MOC7-100,CSB-EP720284MOC7-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Chondroitin sulfate proteoglycan core protein 2,Large fibroblast proteoglycan,PG-M

Produkteigenschaften

• Molekulargewicht: 20.4 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q62059
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 24-146aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA