Recombinant Mouse Versican core protein (Vcan), partial
Catalog Number:
CSB-EP720284MOC7
- Images (0)
| Article Name: | Recombinant Mouse Versican core protein (Vcan), partial |
| Biozol Catalog Number: | CSB-EP720284MOC7 |
| Supplier Catalog Number: | CSB-EP720284MOc7 |
| Alternative Catalog Number: | CSB-EP720284MOC7-1,CSB-EP720284MOC7-100,CSB-EP720284MOC7-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Chondroitin sulfate proteoglycan core protein 2,Large fibroblast proteoglycan,PG-M |
| Molecular Weight: | 20.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q62059 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-146aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA |
Product Guarantee and Expert Support
