Recombinant Rat RanBP-type and C3HC4-type zinc finger-containing protein 1 (Rbck1)

Artikelnummer: CSB-EP720325RA
Artikelname: Recombinant Rat RanBP-type and C3HC4-type zinc finger-containing protein 1 (Rbck1)
Artikelnummer: CSB-EP720325RA
Hersteller Artikelnummer: CSB-EP720325RA
Alternativnummer: CSB-EP720325RA-1, CSB-EP720325RA-100, CSB-EP720325RA-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (Heme-oxidized IRP2 ubiquitin ligase 1 homolog)(HOIL-1)(Protein kinase C-binding protein beta-15)(RBCC protein interacting with PKC)(RING-type E3 ubiquitin transferase HOIL-1)(Ubiquitin-conjugating enzyme 7-interacting protein 3)
Molekulargewicht: 65.1 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q62921
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-508aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDEKTKKAEEMALSLARAVTGGDEQAAIKYATWLAEQKVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDSAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQPRGPLEPVLPKPRTHQETGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQIPASYQPDEEERARLAGEEEALRQYEQRKQQQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.