Recombinant Rat RanBP-type and C3HC4-type zinc finger-containing protein 1 (Rbck1)

Catalog Number: CSB-EP720325RA
Article Name: Recombinant Rat RanBP-type and C3HC4-type zinc finger-containing protein 1 (Rbck1)
Biozol Catalog Number: CSB-EP720325RA
Supplier Catalog Number: CSB-EP720325RA
Alternative Catalog Number: CSB-EP720325RA-1, CSB-EP720325RA-100, CSB-EP720325RA-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Heme-oxidized IRP2 ubiquitin ligase 1 homolog)(HOIL-1)(Protein kinase C-binding protein beta-15)(RBCC protein interacting with PKC)(RING-type E3 ubiquitin transferase HOIL-1)(Ubiquitin-conjugating enzyme 7-interacting protein 3)
Molecular Weight: 65.1 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q62921
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-508aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDEKTKKAEEMALSLARAVTGGDEQAAIKYATWLAEQKVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDSAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQPRGPLEPVLPKPRTHQETGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQIPASYQPDEEERARLAGEEEALRQYEQRKQQQ
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.