Recombinant Chicken Gallin protein (gallin_2)

Artikelnummer: CSB-EP7580CH
Artikelname: Recombinant Chicken Gallin protein (gallin_2)
Artikelnummer: CSB-EP7580CH
Hersteller Artikelnummer: CSB-EP7580CH
Alternativnummer: CSB-EP7580CH-1, CSB-EP7580CH-100, CSB-EP7580CH-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Molekulargewicht: 22.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: D5GR58
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.88.
Quelle: E.coli
Expression System: 23-63aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK
Anwendungsbeschreibung: Research Areas: Others