Recombinant Chicken Gallin protein (gallin_2)

Catalog Number: CSB-EP7580CH
Article Name: Recombinant Chicken Gallin protein (gallin_2)
Biozol Catalog Number: CSB-EP7580CH
Supplier Catalog Number: CSB-EP7580CH
Alternative Catalog Number: CSB-EP7580CH-1, CSB-EP7580CH-100, CSB-EP7580CH-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 22.9 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: D5GR58
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.88.
Source: E.coli
Expression System: 23-63aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LVLKYCPKIGYCSNTCSKTQIWATSHGCKMYCCLPASWKWK
Application Notes: Research Areas: Others