Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)

Artikelnummer: CSB-EP7653AXL
Artikelname: Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)
Artikelnummer: CSB-EP7653AXL
Hersteller Artikelnummer: CSB-EP7653AXL
Alternativnummer: CSB-EP7653AXL-1, CSB-EP7653AXL-100, CSB-EP7653AXL-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: obp3
Molekulargewicht: 20.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: C1KUY3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-118aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: RFTTEQIDYYGKACNASEDDLVVVKSYKVPTTETGKCLMKCMITKLGLLNDDGSYNKTGMEAGLKKYWSEWSTEKIESINNKCYEEALLVSKEVVATCNYSYTVMACLNKQLDLDKST
Anwendungsbeschreibung: Research Areas: Others