Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)

Catalog Number: CSB-EP7653AXL
Article Name: Recombinant Acyrthosiphon pisum Odorant-binding protein3 (obp3)
Biozol Catalog Number: CSB-EP7653AXL
Supplier Catalog Number: CSB-EP7653AXL
Alternative Catalog Number: CSB-EP7653AXL-1, CSB-EP7653AXL-100, CSB-EP7653AXL-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: obp3
Molecular Weight: 20.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: C1KUY3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-118aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RFTTEQIDYYGKACNASEDDLVVVKSYKVPTTETGKCLMKCMITKLGLLNDDGSYNKTGMEAGLKKYWSEWSTEKIESINNKCYEEALLVSKEVVATCNYSYTVMACLNKQLDLDKST
Application Notes: Research Areas: Others