Recombinant Human Protein mono-ADP-ribosyltransferase TIPARP (TIPARP)

Artikelnummer: CSB-EP801800HU
Artikelname: Recombinant Human Protein mono-ADP-ribosyltransferase TIPARP (TIPARP)
Artikelnummer: CSB-EP801800HU
Hersteller Artikelnummer: CSB-EP801800HU
Alternativnummer: CSB-EP801800HU-1, CSB-EP801800HU-100, CSB-EP801800HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: (ADP-ribosyltransferase diphtheria toxin-like 14)(ARTD14)(Poly [ADP-ribose] polymerase 7)(PARP-7)(TCDD-inducible poly [ADP-ribose] polymerase)
Molekulargewicht: 82.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q7Z3E1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-657aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.