Recombinant Human Protein mono-ADP-ribosyltransferase TIPARP (TIPARP)

Catalog Number: CSB-EP801800HU
Article Name: Recombinant Human Protein mono-ADP-ribosyltransferase TIPARP (TIPARP)
Biozol Catalog Number: CSB-EP801800HU
Supplier Catalog Number: CSB-EP801800HU
Alternative Catalog Number: CSB-EP801800HU-1, CSB-EP801800HU-100, CSB-EP801800HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (ADP-ribosyltransferase diphtheria toxin-like 14)(ARTD14)(Poly [ADP-ribose] polymerase 7)(PARP-7)(TCDD-inducible poly [ADP-ribose] polymerase)
Molecular Weight: 82.2 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q7Z3E1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-657aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDHSFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTELFQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.