Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial
Artikelnummer:
CSB-EP803148HU
- Bilder (0)
| Artikelname: | Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial |
| Artikelnummer: | CSB-EP803148HU |
| Hersteller Artikelnummer: | CSB-EP803148HU |
| Alternativnummer: | CSB-EP803148HU-1,CSB-EP803148HU-100,CSB-EP803148HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Goliath homolog,RING finger protein 130,RING-type E3 ubiquitin transferase RNF130 |
| Molekulargewicht: | 25.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | Q86XS8 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | E.coli |
| Expression System: | 28-194aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGS |
Produktgarantie und fachkundiger Support
