Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial

Catalog Number: CSB-EP803148HU
Article Name: Recombinant Human E3 ubiquitin-protein ligase RNF130 (RNF130), partial
Biozol Catalog Number: CSB-EP803148HU
Supplier Catalog Number: CSB-EP803148HU
Alternative Catalog Number: CSB-EP803148HU-1, CSB-EP803148HU-100, CSB-EP803148HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Goliath homolog,RING finger protein 130,RING-type E3 ubiquitin transferase RNF130
Molecular Weight: 25.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q86XS8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 28-194aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DNASQEYYTALINVTVQEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQTRFFVPPNIKQWIALLQRGNCTFKEKISRAAFHNAVAVVIYNNKSKEEPVTMTHPGTGDIIAVMITELRGKDILSYLEKNISVQMTIAVGTRMPPKNFSRGS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.