Recombinant Human Probable palmitoyltransferase ZDHHC12 (ZDHHC12), partial

Artikelnummer: CSB-EP822219HU1
Artikelname: Recombinant Human Probable palmitoyltransferase ZDHHC12 (ZDHHC12), partial
Artikelnummer: CSB-EP822219HU1
Hersteller Artikelnummer: CSB-EP822219HU1
Alternativnummer: CSB-EP822219HU1-1, CSB-EP822219HU1-100, CSB-EP822219HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: DHHC domain-containing cysteine-rich protein 12,Zinc finger DHHC domain-containing protein 12,Zinc finger protein 400
Molekulargewicht: 22.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q96GR4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.189.
Quelle: E.coli
Expression System: 65-140aa
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP
Anwendungsbeschreibung: Research Areas: Cancer