Recombinant Human Probable palmitoyltransferase ZDHHC12 (ZDHHC12), partial

Catalog Number: CSB-EP822219HU1
Article Name: Recombinant Human Probable palmitoyltransferase ZDHHC12 (ZDHHC12), partial
Biozol Catalog Number: CSB-EP822219HU1
Supplier Catalog Number: CSB-EP822219HU1
Alternative Catalog Number: CSB-EP822219HU1-1, CSB-EP822219HU1-100, CSB-EP822219HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DHHC domain-containing cysteine-rich protein 12,Zinc finger DHHC domain-containing protein 12,Zinc finger protein 400
Molecular Weight: 22.1 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q96GR4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.189.
Source: E.coli
Expression System: 65-140aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLMDPGYVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP
Application Notes: Research Areas: Cancer