Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial

Artikelnummer: CSB-EP822250HU1
Artikelname: Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial
Artikelnummer: CSB-EP822250HU1
Hersteller Artikelnummer: CSB-EP822250HU1
Alternativnummer: CSB-EP822250HU1-1, CSB-EP822250HU1-100, CSB-EP822250HU1-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Sensory neuron-specific G-protein coupled receptor 3/4
Molekulargewicht: 12.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q96LB2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.83.
Quelle: E.coli
Expression System: 276-322aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
Anwendungsbeschreibung: Research Areas: Neuroscience