Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial

Catalog Number: CSB-EP822250HU1
Article Name: Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial
Biozol Catalog Number: CSB-EP822250HU1
Supplier Catalog Number: CSB-EP822250HU1
Alternative Catalog Number: CSB-EP822250HU1-1, CSB-EP822250HU1-100, CSB-EP822250HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Sensory neuron-specific G-protein coupled receptor 3/4
Molecular Weight: 12.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q96LB2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.83.
Source: E.coli
Expression System: 276-322aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ
Application Notes: Research Areas: Neuroscience