Recombinant Human Cell migration-inducing and hyaluronan-binding protein(CEMIP), partial

Artikelnummer: CSB-EP845143HU
Artikelname: Recombinant Human Cell migration-inducing and hyaluronan-binding protein(CEMIP), partial
Artikelnummer: CSB-EP845143HU
Hersteller Artikelnummer: CSB-EP845143HU
Alternativnummer: CSB-EP845143HU-1, CSB-EP845143HU-100, CSB-EP845143HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Hyaluronan binding protein involved in hyaluronan depolymerization
Molekulargewicht: 18.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8WUJ3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 881-980aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL
Anwendungsbeschreibung: Research Areas: Others. Endotoxin: Not test