Recombinant Human Cell migration-inducing and hyaluronan-binding protein(CEMIP), partial

Catalog Number: CSB-EP845143HU
Article Name: Recombinant Human Cell migration-inducing and hyaluronan-binding protein(CEMIP), partial
Biozol Catalog Number: CSB-EP845143HU
Supplier Catalog Number: CSB-EP845143HU
Alternative Catalog Number: CSB-EP845143HU-1, CSB-EP845143HU-100, CSB-EP845143HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hyaluronan binding protein involved in hyaluronan depolymerization
Molecular Weight: 18.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8WUJ3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 881-980aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNWL
Application Notes: Research Areas: Others. Endotoxin: Not test