Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Artikelnummer: CSB-EP851556HU
Artikelname: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial
Artikelnummer: CSB-EP851556HU
Hersteller Artikelnummer: CSB-EP851556HU
Alternativnummer: CSB-EP851556HU-1, CSB-EP851556HU-100, CSB-EP851556HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: ADAMTS21
Molekulargewicht: 15.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8TE60
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 942-1047aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.