Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Catalog Number: CSB-EP851556HU
Article Name: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial
Biozol Catalog Number: CSB-EP851556HU
Supplier Catalog Number: CSB-EP851556HU
Alternative Catalog Number: CSB-EP851556HU-1, CSB-EP851556HU-100, CSB-EP851556HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ADAMTS21
Molecular Weight: 15.5 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q8TE60
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 942-1047aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.