Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Artikelnummer: CSB-EP856431HU10
Artikelname: Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Artikelnummer: CSB-EP856431HU10
Hersteller Artikelnummer: CSB-EP856431HU10
Alternativnummer: CSB-EP856431HU10-1, CSB-EP856431HU10-100, CSB-EP856431HU10-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: 68 kDa TATA-binding protein-associated factor,RNA-binding protein 56
Molekulargewicht: 15.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q92804
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.71.
Quelle: E.coli
Expression System: 1-109aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPD
Anwendungsbeschreibung: Research Areas: Epigenetics and Nuclear Signaling