Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Catalog Number: CSB-EP856431HU10
Article Name: Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
Biozol Catalog Number: CSB-EP856431HU10
Supplier Catalog Number: CSB-EP856431HU10
Alternative Catalog Number: CSB-EP856431HU10-1, CSB-EP856431HU10-100, CSB-EP856431HU10-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 68 kDa TATA-binding protein-associated factor,RNA-binding protein 56
Molecular Weight: 15.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: Q92804
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.71.
Source: E.coli
Expression System: 1-109aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPD
Application Notes: Research Areas: Epigenetics and Nuclear Signaling