Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)

Produktübersicht

• Artikelname: Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)
• Artikelnummer: CSB-EP864008HU(F2)
• Hersteller Artikelnummer: CSB-EP864008HU(F2)
• Alternativnummer: CSB-EP864008HU(F2)-1, CSB-EP864008HU(F2)-100, CSB-EP864008HU(F2)-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Duranin

Produkteigenschaften

• Molekulargewicht: 59.5 kDa
• Tag: N-terminal 6xHis-SUMO-tagged
• UniProt: Q9H9P8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: E.coli
• Expression System: 52-441aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDS

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.