Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)

Catalog Number: CSB-EP864008HU(F2)
Article Name: Recombinant Human L-2-hydroxyglutarate dehydrogenase, mitochondrial (L2HGDH)
Biozol Catalog Number: CSB-EP864008HU(F2)
Supplier Catalog Number: CSB-EP864008HU(F2)
Alternative Catalog Number: CSB-EP864008HU(F2)-1, CSB-EP864008HU(F2)-100, CSB-EP864008HU(F2)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Duranin
Molecular Weight: 59.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9H9P8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 52-441aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VIVGGGIVGLASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCRGLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPIVIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNIYPVPDS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.