Recombinant Human Disintegrin and metalloproteinase domain-containing protein 22 (ADAM22), partial

Artikelnummer: CSB-EP865198HU
Artikelname: Recombinant Human Disintegrin and metalloproteinase domain-containing protein 22 (ADAM22), partial
Artikelnummer: CSB-EP865198HU
Hersteller Artikelnummer: CSB-EP865198HU
Alternativnummer: CSB-EP865198HU-1, CSB-EP865198HU-100, CSB-EP865198HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: Metalloproteinase-disintegrin ADAM22-3,Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Molekulargewicht: 63.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9P0K1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.230.
Quelle: E.coli
Expression System: 223-736aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKC
Anwendungsbeschreibung: Research Areas: Neuroscience