Recombinant Human Disintegrin and metalloproteinase domain-containing protein 22 (ADAM22), partial

Catalog Number: CSB-EP865198HU
Article Name: Recombinant Human Disintegrin and metalloproteinase domain-containing protein 22 (ADAM22), partial
Biozol Catalog Number: CSB-EP865198HU
Supplier Catalog Number: CSB-EP865198HU
Alternative Catalog Number: CSB-EP865198HU-1, CSB-EP865198HU-100, CSB-EP865198HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Metalloproteinase-disintegrin ADAM22-3,Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Molecular Weight: 63.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9P0K1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.230.
Source: E.coli
Expression System: 223-736aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKC
Application Notes: Research Areas: Neuroscience