Recombinant Mouse Z-DNA-binding protein 1 (Zbp1)

Artikelnummer: CSB-EP865587MOA6
Artikelname: Recombinant Mouse Z-DNA-binding protein 1 (Zbp1)
Artikelnummer: CSB-EP865587MOA6
Hersteller Artikelnummer: CSB-EP865587MOa6
Alternativnummer: CSB-EP865587MOA6-1, CSB-EP865587MOA6-100, CSB-EP865587MOA6-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: DNA-dependent activator of IFN-regulatory factors,DAI,Tumor stroma and activated macrophage protein DLM-1
Molekulargewicht: 58.9 kDa
Tag: N-terminal 6xHis-B2M-tagged
UniProt: Q9QY24
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: E.coli
Expression System: 1-411aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MAEAPVDLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGGAASGDGAPAIPENSSAQPSLDERILRFLEANGPHRALHIAKALGMTTAKEVNPLLYSMRNKHLLSYDGQTWKIYHSRQEGQDIAHSGVTQESPAIICQHNPVNMICQQGANSHISIANSNAIQIGHGNVIVREKACGEPGPRTSHPLPLAWDASAQDMPPVAHGAQYIYMDKSLLQQVQLGHHNE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.